PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn063851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 418aa    MW: 46671.2 Da    PI: 7.4207
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn063851genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.7e-3346100155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kprl+Wt++LHerF+eav+qLGG++kAtPkt+l+ m+++gLtl+h+kSHLQkYRl
  Achn063851  46 KPRLKWTQDLHERFIEAVNQLGGADKATPKTVLKYMGIPGLTLYHLKSHLQKYRL 100
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.87643103IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-3044101IPR009057Homeodomain-like
SuperFamilySSF466891.31E-1645101IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-2346101IPR006447Myb domain, plants
PfamPF002492.9E-104899IPR001005SANT/Myb domain
PfamPF143797.6E-23142189IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MYHHHHHQGK NIHPSSRVSI PPERHLFLQG GNGGGDSGLV LSTDAKPRLK WTQDLHERFI  60
EAVNQLGGAD KATPKTVLKY MGIPGLTLYH LKSHLQKYRL SKNLHVQANS GGNKTVAGER  120
MSETNGTHTS NPNIGPQTNK SIQIGEAIQM QIEGQRRLHE QLEVQRHLQL RIEAQGKYLQ  180
SVLEKAQETL GRQNLGTVGL EDAKVQISEL VSKVSTQCLN STFSGMKELS GGLCPQQRQA  240
SQPTDCSMDS CLTFCEGSQR DQDMHKNGMG LIAFNSDAPF WPKEVNNEPR PQQSELRFCE  300
DLKENRKFLS LMGKNTERAF PIEVNSDDLS MGVGLQGGNG TSSSSSYLER RFRGMDEDLN  360
FREQMTSRTD SIQQEDEKMS RGYKLPYFAP KLDLNARDEN DAASNCKQID LNGFSWS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011034346.10.0PREDICTED: uncharacterized protein LOC105132500 isoform X1
TrEMBLB9I5Z80.0B9I5Z8_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0013s05670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-128G2-like family protein